' x='0' y='0' width='795' height='447'%3E%3C/rect%3E%3Ctext id='Loading-Preview' font-family='AvenirNext-Bold, Avenir Next' font-size='42' font-weight='bold' fill='%23FFFFFF'%3E%3Ctspan x='128.715' y='241'%3ELoading Preview%3C/tspan%3E%3C/text%3E%3C/g%3E%3C/g%3E%3C/svg%3E)
Domain Name: |
rybbon.net |
Registration Date: |
2014-05-11T14:51:53Z |
Expiration Date: | 2024-05-11T14:51:53Z |
Registrar URL: | GoDaddy.com, LLC |
Registrar Contact: | 480-624-2505 |
Hosted In: | |
Safety: | Safe |
Domain Extension: | .net |
IP address: | 34.196.126.222 |
Alexa Rank: |
84270 |
OverAll Traffic Chart |
Search-Engine Traffic Chart |
|
|
|
Google Safe Browsing: |
Safe |
WOT Trustworthiness: |
# |
Siteadvisor Rating: |
# |
City: |
|
Country Name: |
|
Latitude: |
|
Longitude: |
| Host | Type | Class | TTL | Target |
| rybbon.net | A | IN | 59 | |
| rybbon.net | A | IN | 59 | |
| rybbon.net | NS | IN | 21599 | ns-1041.awsdns-02.org |
| rybbon.net | NS | IN | 21599 | ns-12.awsdns-01.com |
| rybbon.net | NS | IN | 21599 | ns-1559.awsdns-02.co.uk |
| rybbon.net | NS | IN | 21599 | ns-553.awsdns-05.net |
| rybbon.net | SOA | IN | 899 | |
| rybbon.net | MX | IN | 3599 | aspmx.l.google.com |
| rybbon.net | MX | IN | 3599 | alt3.aspmx.l.google.com |
| rybbon.net | MX | IN | 3599 | alt4.aspmx.l.google.com |
| rybbon.net | MX | IN | 3599 | alt1.aspmx.l.google.com |
| rybbon.net | MX | IN | 3599 | alt2.aspmx.l.google.com |
| rybbon.net | TXT | IN | 3599 | |
| rybbon.net | TXT | IN | 3599 | |
| rybbon.net | TXT | IN | 3599 |
Site Status | Congratulations! Your site is alive. |
Title Tag | The meta title of your page has a length of 62 characters. Most search engines will truncate meta titles to 70 characters. -> Digital Gift Management for Marketing & Research Professionals |
Meta Description | The meta description of your page has a length of 142 characters. Most search engines will truncate meta descriptions to 160 characters. -> Send digital e-gift cards as marketing incentives or rewards with Rybbon, which integrates with Marketo, HubSpot, SurveyMonkey, and Qualtrics. |
Google Search Results Preview | Digital Gift Management for Marketing & Research Professionals https://rybbon.net Send digital e-gift cards as marketing incentives or rewards with Rybbon, which integrates with Marketo, HubSpot, SurveyMonkey, and Qualtrics. |
Most Common Keywords Test | There is likely no optimal keyword density (search engine algorithms have evolved beyond
keyword density metrics as a significant ranking factor). It can be useful, however, to note which
keywords appear most often on your page and if they reflect the intended topic of your page. More
importantly, the keywords on your page should appear within natural sounding and grammatically
correct copy. -> cookie - 47 -> by - 32 -> cookies - 27 -> for - 25 -> used - 23 |
Keyword Usage | Your most common keywords are not appearing in one or more of the meta-tags above. Your
primary keywords should appear in your meta-tags to help identify the topic of your webpage to
search engines. |
h1 Headings Status | Your pages having these H1 headigs. -> Delightful rewards, -> Delightful |
h2 Headings Status | Your pages having these H2 headigs. -> awesome resultssurveysresearchleadsreviewsreferralspromotions -> rewards, awesome resultssurveysresearchleadsreviewsreferralspromotions -> Deliver great choices -> 1000+ Brands Trust Rybbon -> Your data is safe with us. |
Robots.txt Test | Your page doesn't have "robots.txt" file |
Sitemap Test | Your page doesn't have "sitemap.xml" file. |
Broken Links Test | Congratulations! Your page doesn't have any broken links. |
Image Alt Test | 46 images found in your page and 18 images are without "ALT" text. |
Google Analytics | Your page not submitted to Google Analytics |
Favicon Test | Your site doesn't have favicon. |
Site Loading Speed Test | Your site loading time is around 1.2062981128693 seconds and the average loading speed of any website which is 5 seconds required. |
Flash Test | Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret. |
Frame Test | Congratulations! Your webpage does not use frames. |
CSS Minification | Your page having 7 external css files and out of them 2 css files are minified. Following files are not minified : https://www.rybbon.net/wp-content/plugins/cookie-law-info/public/css/cookie-law-info-public.css?ver=2.0.3 https://www.rybbon.net/wp-content/plugins/cookie-law-info/public/css/cookie-law-info-gdpr.css?ver=2.0.3 https://www.rybbon.net/wp-content/themes/Divi/style.css?ver=5.7.2 https://www.rybbon.net/wp-content/themes/Startmetric-child-theme/style.css?ver=4.9.6 https://www.rybbon.net/wp-content/plugins/cookie-law-info/public/css/cookie-law-info-table.css?ver=2.0.3 |
JS Minification | Your page having 3 external js files and out of them 2 js files are minified. Following files are not minified : https://www.rybbon.net/wp-content/cache/autoptimize/js/autoptimize_f1bdce6a0af9b2392dcadb20f467e8d0.js |